PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp57577_TGAC_v2_mRNA1876
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
Family CO-like
Protein Properties Length: 282aa    MW: 30863.5 Da    PI: 7.3846
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp57577_TGAC_v2_mRNA1876genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box29.41.7e-09447441
                  zf-B_box  4 rkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvp 41
                              + C+ +++  ++l+C+ ++ +lC dC ++ H        H +v+
  Tp57577_TGAC_v2_mRNA1876  4 KLCDSCKSATATLYCRPDSAFLCSDCDSKVHAAnklasrHPRVT 47
                              68*****************************6567777787765 PP

2zf-B_box24.55.7e-084690341
                  zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvp 41
                               + C+ +e+ +++  C+ +   lC +C   +H+       H++ p
  Tp57577_TGAC_v2_mRNA1876 46 VTLCEVCEQAPAHVTCKADAASLCITCDRDIHSAnplaarHERLP 90
                              578*****************************6688888898876 PP

3CCT70.44.5e-24223266144
                       CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                               Rea++lRYkeKrk+R+FeK+irY+sRKa+Ae+RpR+KGrF+k++
  Tp57577_TGAC_v2_mRNA1876 223 REARVLRYKEKRKNRRFEKTIRYASRKAYAETRPRIKGRFAKRT 266
                               9*****************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003366.7E-14148IPR000315B-box-type zinc finger
PROSITE profilePS5011911.121148IPR000315B-box-type zinc finger
PfamPF006431.6E-7447IPR000315B-box-type zinc finger
CDDcd000211.51E-9548No hitNo description
PROSITE profilePS5011910.6374491IPR000315B-box-type zinc finger
PfamPF006432.5E-64691IPR000315B-box-type zinc finger
CDDcd000212.01E-74791No hitNo description
SMARTSM003363.8E-84991IPR000315B-box-type zinc finger
PfamPF062037.5E-18223265IPR010402CCT domain
PROSITE profilePS5101716.648223265IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 282 aa     Download sequence    Send to blast
MSSKLCDSCK SATATLYCRP DSAFLCSDCD SKVHAANKLA SRHPRVTLCE VCEQAPAHVT  60
CKADAASLCI TCDRDIHSAN PLAARHERLP VTPFFESKSF HNNNNNYDAV KDEAEAASWL  120
ISDPKADLNS SPYMFSDSEA IPFMDLDYGA IEQKNDGVVP VHGNFDPFTS AYKNNTHTEL  180
ETPSPSQISN SVSSSMEVGV VPDGNAVSEI SNCGYGKAVA ADREARVLRY KEKRKNRRFE  240
KTIRYASRKA YAETRPRIKG RFAKRTDAVD SISGYGVVPT C*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCU0135241e-108CU013524.5 M.truncatula DNA sequence from clone MTH2-89B7 on chromosome 3, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003603265.11e-174zinc finger constans-like protein
SwissprotQ940T92e-93COL4_ARATH; Zinc finger protein CONSTANS-LIKE 4
TrEMBLG7JPB91e-174G7JPB9_MEDTR; Uncharacterized protein
STRINGGLYMA06G06300.11e-131(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF13023493
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G24930.16e-93CONSTANS-like 4